🇬🇧United KingdomGeneral practitioner
Hawkesley Medical Practice
Birmingham, EN B38 9TJ·hawkesleymedicalpractice.co.uk·Updated 26 July 2026
Google rating
3.9Good
46 Google reviews
Practitioners
Not detectedLocations
1location
Birmingham
8
Digital maturityMinimal
Yoluko score, out of 100
Site profile
Domainhawkesleymedicalpractice.co.uk
TypeGeneral practitioner
CityBirmingham
StateEN
PostcodeB38 9TJ
CountryUnited Kingdom
Last update26 July 2026
Clinic contact
+44 1214864200
Decision-maker name, role and verified email are in the full profile.
How we know this
- Analysed from public website data
- Cross-checked across multiple sources
- Re-verified every week
Technology stack
1 of 13 categories detectedClinical systems
0/4Practice Management (PMS)Not detected
Online BookingNot detected
TelehealthNot detected
PaymentsNot detected
Marketing & engagement
1/4CRMNot detected
FormsNot detected
Live ChatNot detected
Email PlatformMicrosoft 365
Web & analytics
0/3CMS / Website BuilderNot detected
Advertising PixelsNot detected
AnalyticsNot detected
Reputation
0/2Review PlatformNot detected
Displayed ReviewsNot detected
Locked in this profile
This is the free preview.
The full profile goes deeper.
Decision-maker contacts, market positioning, migration signals, review analytics, and 50+ fields across 64,000+ UK clinics. Updated weekly, last refresh 26 July 2026.
Market intelligence
PMS market shareVendor vs competitors
Similar clinicsEN clinics on same stack
Migration signalsRecent tool switches
Competitive positioningTech maturity vs peers
Decision-maker contacts
Owner / Practice ManagerDr. Sarah M—
Verified emails.m—@southst—
LinkedIn profilelinkedin.com/in/—
Last verifiedJuly 2026
Review breakdown
5-star share87% of reviews
1-star count3 reviews
Review velocity+12 / month
Direct reviews linkg.page/—
Billing & insurance
Billing typeMixed billing
Bulk billingYes / partial
NDIS / DVA / WorkCoverCoverage flags
All 1 locations
Street addresses1 addresses
Per-location ratingsIndividual ratings
Per-location contactsPhone, email
Google Maps linksDirect links
Digital timeline
Online since2018
Domain age6 years
Direct booking URLFull URL
Hosting providerAWS / Netlify / etc.
Get the full profile for Hawkesley Medical Practice
50+ fields, verified weekly. For this clinic, or a custom extract of the UK healthcare market.
Sample in 24h
CSV, Sheets or API
Weekly refresh
Not ready yet? Get free weekly signals.