🇬🇧United KingdomChiropractor
Advanced Pain Relief and Chinese Medicine Clinic MK
Milton Keynes, EN MK6 3AQ·advancedpainreliefclinicmk.co.uk·Updated 23 July 2026
Google rating
4.8Excellent
155 Google reviews
Practitioners
1team members
Larger than 0% of EN clinics
Locations
1location
Milton Keynes
31
Digital maturityMedium
Yoluko score, out of 100
Site profile
Domainadvancedpainreliefclinicmk.co.uk
TypeChiropractor
CityMilton Keynes
StateEN
PostcodeMK6 3AQ
Booking flowexternal_vendor
CountryUnited Kingdom
Last update23 July 2026
Clinic contact
+44 1908690544advancedpainreliefclinicmk.co.uk@pm.me
Decision-maker name, role and verified email are in the full profile.
How we know this
- Analysed from public website data
- Cross-checked across multiple sources
- Re-verified every week
Technology stack
4 of 13 categories detectedClinical systems
2/4Marketing & engagement
1/4CRMNot detected
FormsDivi Contact Form, Popup Maker
Live ChatNot detected
Email PlatformNot detected
Web & analytics
1/3CMS / Website BuilderWordPress (Divi)
Advertising PixelsNot detected
AnalyticsNot detected
Reputation
0/2Review PlatformNot detected
Displayed ReviewsNot detected
Locked in this profile
This is the free preview.
The full profile goes deeper.
Decision-maker contacts, market positioning, migration signals, review analytics, and 50+ fields across 64,000+ UK clinics. Updated weekly, last refresh 23 July 2026.
Market intelligence
PMS market shareCliniko vs competitors
Similar clinicsEN clinics on same stack
Migration signalsRecent tool switches
Competitive positioningTech maturity vs peers
Decision-maker contacts
Owner / Practice ManagerDr. Sarah M—
Verified emails.m—@southst—
LinkedIn profilelinkedin.com/in/—
Last verifiedJuly 2026
Review breakdown
5-star share87% of reviews
1-star count3 reviews
Review velocity+12 / month
Direct reviews linkg.page/—
Billing & insurance
Billing typeMixed billing
Bulk billingYes / partial
NDIS / DVA / WorkCoverCoverage flags
All 1 locations
Street addresses1 addresses
Per-location ratingsIndividual ratings
Per-location contactsPhone, email
Google Maps linksDirect links
Digital timeline
Online since2018
Domain age6 years
Direct booking URLFull URL
Hosting providerAWS / Netlify / etc.
Get the full profile for Advanced Pain Relief and Chinese Medicine Clinic MK
50+ fields, verified weekly. For this clinic, or a custom extract of the UK healthcare market.
Sample in 24h
CSV, Sheets or API
Weekly refresh
Not ready yet? Get free weekly signals.