🇬🇧United KingdomPet groomer
Little Paws Fertility Clinic
Trowbridge, EN BA14 0PU·littlepawsfertilityclinic.co.uk·Updated 23 July 2026
Google rating
4.8Excellent
16 Google reviews
Practitioners
Not detectedLocations
1location
Trowbridge
38
Digital maturityMedium
Yoluko score, out of 100
Site profile
Domainlittlepawsfertilityclinic.co.uk
TypePet groomer
CityTrowbridge
StateEN
PostcodeBA14 0PU
Booking flowlead_form
CountryUnited Kingdom
Last update23 July 2026
Clinic contact
+44 7525727655ljsp666@hotmail.co.uk
Decision-maker name, role and verified email are in the full profile.
How we know this
- Analysed from public website data
- Cross-checked across multiple sources
- Re-verified every week
Technology stack
5 of 13 categories detectedClinical systems
1/4Practice Management (PMS)Not detected
Online BookingWPForms
TelehealthNot detected
PaymentsNot detected
Marketing & engagement
2/4CRMNot detected
FormsElementor Forms, WPForms
Live ChatNot detected
Email Platformprivateemail
Web & analytics
1/3CMS / Website BuilderWooCommerce, WordPress (Astra), WordPress (Beaver Builder), WordPress (Elementor)
Advertising PixelsNot detected
AnalyticsNot detected
Reputation
1/2Review PlatformNot detected
Displayed ReviewsGoogle Reviews
Locked in this profile
This is the free preview.
The full profile goes deeper.
Decision-maker contacts, market positioning, migration signals, review analytics, and 50+ fields across 64,000+ UK clinics. Updated weekly, last refresh 23 July 2026.
Market intelligence
PMS market shareVendor vs competitors
Similar clinicsEN clinics on same stack
Migration signalsRecent tool switches
Competitive positioningTech maturity vs peers
Decision-maker contacts
Owner / Practice ManagerDr. Sarah M—
Verified emails.m—@southst—
LinkedIn profilelinkedin.com/in/—
Last verifiedJuly 2026
Review breakdown
5-star share87% of reviews
1-star count3 reviews
Review velocity+12 / month
Direct reviews linkg.page/—
Billing & insurance
Billing typeMixed billing
Bulk billingYes / partial
NDIS / DVA / WorkCoverCoverage flags
All 1 locations
Street addresses1 addresses
Per-location ratingsIndividual ratings
Per-location contactsPhone, email
Google Maps linksDirect links
Digital timeline
Online since2018
Domain age6 years
Direct booking URLFull URL
Hosting providerAWS / Netlify / etc.
Get the full profile for Little Paws Fertility Clinic
50+ fields, verified weekly. For this clinic, or a custom extract of the UK healthcare market.
Sample in 24h
CSV, Sheets or API
Weekly refresh
Not ready yet? Get free weekly insights.